-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human PAK2 (NP_002568.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human PAK2 (NP_002568.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02568A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAK2 |
| Target Synonyms | KNO2; PAK65; PAKgamma; PAK2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human PAK2 (NP_002568.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIV | Uniprot ID | Q13177 |
Uniprot Id
Q13177
Target Species
Human
Target Name
PAK2
Target Full Name
Serine/threonine-protein kinase PAK 2
Target Function
Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell motility, cell cycle progression, apoptosis or proliferation. Acts as downstream effector of the small GTPases CDC42 and RAC1. Activation by the binding of active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Full-length PAK2 stimulates cell survival and cell growth. Phosphorylates MAPK4 and MAPK6 and activates the downstream target MAPKAPK5, a regulator of F-actin polymerization and cell migration. Phosphorylates JUN and plays an important role in EGF-induced cell proliferation. Phosphorylates many other substrates including histone H4 to promote assembly of H3.3 and H4 into nucleosomes, BAD, ribosomal protein S6, or MBP. Additionally, associates with ARHGEF7 and GIT1 to perform kinase-independent functions such as spindle orientation control during mitosis. On the other hand, apoptotic stimuli such as DNA damage lead to caspase-mediated cleavage of PAK2, generating PAK-2p34, an active p34 fragment that translocates to the nucleus and promotes cellular apoptosis involving the JNK signaling pathway. Caspase-activated PAK2 phosphorylates MKNK1 and reduces cellular translation.
Target Subcellular Location
[Serine/threonine-protein kinase PAK 2]: Cytoplasm. Note=MYO18A mediates the cellular distribution of the PAK2-ARHGEF7-GIT1 complex to the inner surface of the cell membrane.; [PAK-2p34]: Nucleus. Cytoplasm, perinuclear region. Membrane; Lipid-anchor. Note=Interaction with ARHGAP10 probably changes PAK-2p34 location to cytoplasmic perinuclear region. Myristoylation changes PAK-2p34 location to the membrane.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily
Target Tissue Specificity
Ubiquitously expressed. Higher levels seen in skeletal muscle, ovary, thymus and spleen.
Target Synonyms
C-t-PAK2; CB422; EC 2.7.11.1 ; Gamma PAK; Gamma-PAK; hPAK65; Kinase; p21 (CDKN1A) activated kinase 2; p21 (CDKN1A)-activated kinase 2a; p21 activated kinase 2 ; p21 protein (Cdc42/Rac)-activated kinase 2; p21 protein Cdc42 Rac activated kinase 2; p21-activated kinase 2; p21-activated kinase; 65-KD; p21-activated protein kinase I; p21CDKN1A activated kinase 2; p27; p34; p58; p65PAK; PAK 2 ; PAK-2; PAK-2p34; Pak2; PAK2_HUMAN; PAK65; PAKgamma; S6 H4 kinase; S6/H4 kinase; Serine threonine protein kinase PAK 2; Serine/threonine protein kinase PAK 2
Target Background
The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell.
Notification