Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAQR8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human PAQR8 (NP_588608.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAQR8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human PAQR8 (NP_588608.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02253A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAQR8 |
| Target Synonyms | MPRB; LMPB1; C6orf33; PAQR8 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human PAQR8 (NP_588608.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNE | Uniprot ID | Q8TEZ7 |
Uniprot Id
Q8TEZ7
Target Species
Human
Target Name
PAQR8
Target Full Name
Membrane progestin receptor beta
Target Function
Plasma membrane progesterone (P4) receptor coupled to G proteins. Seems to act through a G(i) mediated pathway. May be involved in oocyte maturation. Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
ADIPOR family
Target Tissue Specificity
Highly expressed in the hypothalamus. Also expressed in spinal cord, kidney and testis.
Target Synonyms
PAQR8; C6orf33; LMPB1; MPRB; Membrane progestin receptor beta; mPR beta; Lysosomal membrane protein in brain 1; Membrane progesterone P4 receptor beta; Membrane progesterone receptor beta; Progesterone and adipoQ receptor family member 8; Progestin and adipoQ receptor family member 8; Progestin and adipoQ receptor family member VIII
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
