Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Parathyroid Hormone (PTH) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-115 of human Parathyroid Hormone (Parathyroid Hormone (PTH)) (NP_000306.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Parathyroid Hormone (PTH) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-115 of human Parathyroid Hormone (Parathyroid Hormone (PTH)) (NP_000306.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03646A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Parathyroid Hormone (PTH) |
| Target Synonyms | FIH1; PTH1; Parathyroid Hormone (PTH) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-115 of human Parathyroid Hormone (Parathyroid Hormone (PTH)) (NP_000306.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ | Uniprot ID | P01270 |
Uniprot Id
P01270
Target Species
Human
Target Name
PTH
Target Full Name
Parathyroid hormone
Target Function
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
Target Involvement
Hypoparathyroidism, familial isolated (FIH)
Target Subcellular Location
Secreted.
Target Protein Families
Parathyroid hormone family
Target Synonyms
FIH1; PTH1; Parathyroid Hormone (PTH)
Target Background
This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
