-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PARL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human PARL (NP_001032728.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PARL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human PARL (NP_001032728.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08667A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PARL |
| Target Synonyms | PSARL; PSARL1; RHBDS1; PRO2207; PSENIP2; PARL | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human PARL (NP_001032728.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVT | Uniprot ID | Q9H300 |
Uniprot Id
Q9H300
Target Species
Human
Target Name
PARL
Target Full Name
Presenilin-associated rhomboid-like protein, mitochondrial
Target Function
Required for the control of apoptosis during postnatal growth. Essential for proteolytic processing of an antiapoptotic form of OPA1 which prevents the release of mitochondrial cytochrome c in response to intrinsic apoptotic signals. Required for the maturation of PINK1 into its 52kDa mature form after its cleavage by mitochondrial-processing peptidase (MPP). Promotes changes in mitochondria morphology regulated by phosphorylation of P-beta domain.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.; [P-beta]: Nucleus.
Target Protein Families
Peptidase S54 family
Target Synonyms
PARL; PSARL; PRO2207; Presenilins-associated rhomboid-like protein, mitochondrial; Mitochondrial intramembrane cleaving protease PARL
Target Background
This gene encodes a member of the rhomboid family of intramembrane serine proteases that is localized to the inner mitochondrial membrane. The encoded protein regulates mitochondrial remodeling and apoptosis through regulated substrate proteolysis. Proteolytic processing of the encoded protein results in the release of a small peptide, P-beta, which may transit to the nucleus. Mutations in this gene may be associated with Parkinson's disease.
Notification