-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PARP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PARP1 (NP_001609.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PARP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PARP1 (NP_001609.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11729A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PARP1 |
| Target Synonyms | PARP; PARS; PPOL; ADPRT; ARTD1; ADPRT1; PARP-1; ADPRT 1; pADPRT-1; Poly-PARP; PARP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BT-474, Jurkat, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PARP1 (NP_001609.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG | Uniprot ID | P09874 |
Uniprot Id
P09874
Target Species
Human
Target Name
PARP1
Target Full Name
Poly [ADP-ribose] polymerase 1
Target Function
Poly-ADP-ribosyltransferase that mediates poly-ADP-ribosylation of proteins and plays a key role in DNA repair. Mediates glutamate, aspartate, serine or tyrosine ADP-ribosylation of proteins: the ADP-D-ribosyl group of NAD(+) is transferred to the acceptor carboxyl group of target residues and further ADP-ribosyl groups are transferred to the 2'-position of the terminal adenosine moiety, building up a polymer with an average chain length of 20-30 units. Serine ADP-ribosylation of proteins constitutes the primary form of ADP-ribosylation of proteins in response to DNA damage. Mainly mediates glutamate and aspartate ADP-ribosylation of target proteins in absence of HPF1. Following interaction with HPF1, catalyzes serine ADP-ribosylation of target proteins; HPF1 conferring serine specificity by completing the PARP1 active site. Also catalyzes tyrosine ADP-ribosylation of target proteins following interaction with HPF1. PARP1 initiates the repair of DNA breaks: recognizes and binds DNA breaks within chromatin and recruits HPF1, licensing serine ADP-ribosylation of target proteins, such as histones, thereby promoting decompaction of chromatin and the recruitment of repair factors leading to the reparation of DNA strand breaks. In addition to base excision repair (BER) pathway, also involved in double-strand breaks (DSBs) repair: together with TIMELESS, accumulates at DNA damage sites and promotes homologous recombination repair by mediating poly-ADP-ribosylation. Mediates the poly(ADP-ribosyl)ation of a number of proteins, including itself, APLF and CHFR. In addition to proteins, also able to ADP-ribosylate DNA: catalyzes ADP-ribosylation of DNA strand break termini containing terminal phosphates and a 2'-OH group in single- and double-stranded DNA, respectively. Required for PARP9 and DTX3L recruitment to DNA damage sites. PARP1-dependent PARP9-DTX3L-mediated ubiquitination promotes the rapid and specific recruitment of 53BP1/TP53BP1, UIMC1/RAP80, and BRCA1 to DNA damage sites. Acts as a regulator of transcription: positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150. Plays a role in the positive regulation of IFNG transcription in T-helper 1 cells as part of an IFNG promoter-binding complex with TXK and EEF1A1. Involved in the synthesis of ATP in the nucleus, together with NMNAT1, PARG and NUDT5. Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming.
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Chromosome.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
ADP ribosyltransferase (NAD+; poly (ADP ribose) polymerase); ADP ribosyltransferase; ADP ribosyltransferase diphtheria toxin like 1; ADP ribosyltransferase NAD(+); ADPRT 1; ADPRT; ADPRT1; ARTD1; msPARP; NAD(+) ADP ribosyltransferase 1; NAD(+) ADP-ribosyltransferase 1; pADPRT 1; pADPRT-1; pADPRT1; PARP 1; PARP; PARP-1; PARP1; PARP1_HUMAN; Poly (ADP ribose) polymerase 1; poly (ADP ribose) polymerase family; member 1; Poly (ADP-ribose) polymerase 1; Poly [ADP-ribose] polymerase 1; Poly(ADP ribose) polymerase; poly(ADP ribose) synthetase; poly(ADP ribosyl)transferase; Poly(ADP-ribosyl)transferase; Poly[ADP ribose] synthetase 1; Poly[ADP-ribose] synthase 1; PPOL; sPARP 1; sPARP1
Target Background
This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes.
Notification