Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PARS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human PARS2 (NP_689481.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PARS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human PARS2 (NP_689481.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00201A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PARS2 |
| Target Synonyms | DEE75; proRS; EIEE75; MT-PRORS; PARS2 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human PARS2 (NP_689481.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HHCAPRRGRRLLLSRVFQPQNLREDRVLSLQDKSDDLTCKSQRLMLQVGLIYPASPGCYHLLPYTVRAMEKLVRVIDQEMQAIGGQKVNMPSLSPAELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAITALIASQKKLSYKQLPFLLYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAAQ | Uniprot ID | Q7L3T8 |
Uniprot Id
Q7L3T8
Target Species
Human
Target Name
PARS2
Target Full Name
Probable proline--tRNA ligase, mitochondrial
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Class-II aminoacyl-tRNA synthetase family
Target Synonyms
PARS2; Probable proline--tRNA ligase; mitochondrial; EC 6.1.1.15; Prolyl-tRNA synthetase; ProRS
Target Background
This gene encodes a putative member of the class II family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of proline to tRNA molecules. Mutations have been found in this gene in some patients with Alpers syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
