Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Parvalbumin (PVALB) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Parvalbumin (Parvalbumin (PVALB)) (NP_002845.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Parvalbumin (PVALB) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Parvalbumin (Parvalbumin (PVALB)) (NP_002845.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12188A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Parvalbumin (PVALB) |
| Target Synonyms | D22S749; Parvalbumin (PVALB) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Parvalbumin (Parvalbumin (PVALB)) (NP_002845.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES | Uniprot ID | P20472 |
Uniprot Id
P20472
Target Species
Human
Target Name
PVALB
Target Full Name
Parvalbumin alpha
Target Function
In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.
Target Protein Families
Parvalbumin family
Target Research Area
Metabolism
Target Synonyms
D22S749; MGC116759; Parvalbumin alpha; PRVA_HUMAN; PVALB
Target Background
The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
