-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAX3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PAX3 (NP_852122.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAX3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PAX3 (NP_852122.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14840A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAX3 |
| Target Synonyms | WS1; WS3; CDHS; HUP2; PAX-3; PAX3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PAX3 (NP_852122.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYCP | Uniprot ID | P23760 |
Uniprot Id
P23760
Target Species
Human
Target Name
PAX3
Target Full Name
Paired box protein Pax-3
Target Function
Transcription factor that may regulate cell proliferation, migration and apoptosis. Involved in neural development and myogenesis. Transcriptional activator of MITF, acting synergistically with SOX10.
Target Involvement
Waardenburg syndrome 1 (WS1); Waardenburg syndrome 3 (WS3); Craniofacial-deafness-hand syndrome (CDHS); Rhabdomyosarcoma 2 (RMS2)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family
Target Synonyms
CDHS; HUP 2; HUP2; MGC120381; MGC120382; MGC120383; MGC120384; MGC134778; Paired box 3; Paired box gene 3; Paired box homeotic gene 3; Paired box protein Pax 3; Paired box protein Pax-3; Paired box protein Pax3; Paired domain gene 3; Paired domain gene HuP2; PAX 3; Pax3; PAX3/FKHR fusion gene; PAX3_HUMAN; Sp; splotch; Waardenburg syndrome 1; WS 1; WS1; WS3
Target Background
This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini.
Notification