-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAX5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAX5 (NP_057953.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAX5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAX5 (NP_057953.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02143A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAX5 |
| Target Synonyms | ALL3; BSAP; PAX-5; PAX5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Daudi | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAX5 (NP_057953.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIA | Uniprot ID | Q02548 |
Uniprot Id
Q02548
Target Species
Human
Target Name
PAX5
Target Full Name
Paired box protein Pax-5
Target Function
Transcription factor that plays an essential role in commitment of lymphoid progenitors to the B-lymphocyte lineage. Fulfills a dual role by repressing B-lineage inappropriate genes and simultaneously activating B-lineage-specific genes. In turn, regulates cell adhesion and migration, induces V(H)-to-D(H)J(H) recombination, facilitates pre-B-cell receptor signaling and promotes development to the mature B-cell stage. Repression of the cohesin-release factor WAPL causes global changes of the chromosomal architecture in pro-B cells to facilitate the generation of a diverse antibody repertoire.; (Microbial infection) Plays an essential role in the maintenance of Epstein-Barr virus genome copy number within the host cell by promoting EBNA1/oriP-dependent binding and transcription. Participates also in the inhibition of lytic EBV reactivation by modulating viral BZLF1 activity.
Target Involvement
Leukemia, acute lymphoblastic, 3 (ALL3)
Target Subcellular Location
Nucleus.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
B cell lineage specific activator; B cell lineage specific activator protein; B cell specific activator protein; B cell specific transcription factor; B-cell-specific transcription factor; BSAP; EBB-1; KLP; Paired box 5; Paired box gene 5 (B cell lineage specific activator protein); Paired box gene 5 (B cell lineage specific activator); Paired box gene 5; Paired box homeotic gene 5; Paired box protein Pax 5; Paired box protein Pax-5; Paired domain gene 5; PAX 5; PAX5; PAX5_HUMAN; Transcription factor PAX 5
Target Background
This gene encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. Paired box transcription factors are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification