Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAX8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX8 (NP_003457.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAX8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX8 (NP_003457.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11639A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAX8 |
| Target Synonyms | PAX-8; PAX8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, NIH/3T3, OVCAR3, Rat kidney, SKOV3, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX8 (NP_003457.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD | Uniprot ID | Q06710 |
Uniprot Id
Q06710
Target Species
Human
Target Name
PAX8
Target Full Name
Paired box protein Pax-8
Target Function
Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.
Target Involvement
Hypothyroidism, congenital, non-goitrous, 2 (CHNG2)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in the excretory system, thyroid gland and Wilms tumors.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
OTTHUMP00000158659; OTTHUMP00000158660; OTTHUMP00000203723; OTTHUMP00000203724; Paired box 8; Paired box gene 8; paired box homeotic gene 8; Paired box protein Pax 8; Paired box protein Pax-8; Paired domain gene 8; PAX 8; PAX8; PAX8_HUMAN
Target Background
This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
