-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAXIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-394 of human PAXIP1 (NP_031375.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PAXIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-394 of human PAXIP1 (NP_031375.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06734A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAXIP1 |
| Target Synonyms | PTIP; TNRC2; CAGF28; CAGF29; PACIP1; PAXIP1L; PAXIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 301-394 of human PAXIP1 (NP_031375.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GNILPPEVRGNLMAAGQNLQSSERSEMIATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKV | Uniprot ID | Q6ZW49 |
Uniprot Id
Q6ZW49
Target Species
Human
Target Name
PAXIP1
Target Full Name
PAX-interacting protein 1
Target Function
Involved in DNA damage response and in transcriptional regulation through histone methyltransferase (HMT) complexes. Plays a role in early development. In DNA damage response is required for cell survival after ionizing radiation. In vitro shown to be involved in the homologous recombination mechanism for the repair of double-strand breaks (DSBs). Its localization to DNA damage foci requires RNF8 and UBE2N. Recruits TP53BP1 to DNA damage foci and, at least in particular repair processes, effective DNA damage response appears to require the association with TP53BP1 phosphorylated by ATM at 'Ser-25'. Together with TP53BP1 regulates ATM association. Proposed to recruit PAGR1 to sites of DNA damage and the PAGR1:PAXIP1 complex is required for cell survival in response to DNA damage; the function is probably independent of MLL-containing histone methyltransferase (HMT) complexes. However, this function has been questioned. Promotes ubiquitination of PCNA following UV irradiation and may regulate recruitment of polymerase eta and RAD51 to chromatin after DNA damage. Proposed to be involved in transcriptional regulation by linking MLL-containing histone methyltransferase (HMT) complexes to gene promoters by interacting with promoter-bound transcription factors such as PAX2. Associates with gene promoters that are known to be regulated by KMT2D/MLL2. During immunoglobulin class switching in activated B-cells is involved in trimethylation of histone H3 at 'Lys-4' and in transcription initiation of downstream switch regions at the immunoglobulin heavy-chain (Igh) locus; this function appears to involve the recruitment of MLL-containing HMT complexes. Conflictingly, its function in transcriptional regulation during immunoglobulin class switching is reported to be independent of the MLL2/MLL3 complex.
Target Subcellular Location
Nucleus matrix. Chromosome.
Target Synonyms
CAGF 28; CAGF 29; CAGF28; CAGF29; FLJ41049; PACIP 1; PACIP1; PAX interacting (with transcription activation domain) protein 1; PAX interacting protein 1; PAX transactivation activation domain-interacting protein; PAX transcription activation domain interacting protein 1 like; PAX-interacting protein 1; PAXI1_HUMAN; PAXIP 1; PAXIP 1L; paxip1; PAXIP1 protein; PAXIP1L; Protein encoded by CAG trinucleotide repeats; PTIP; TNRC 2; TNRC2
Target Background
This gene is a member of the paired box (PAX) gene family and encodes a nuclear protein with six BRCT (breast cancer carboxy-terminal) domains. This protein plays a critical role in maintaining genome stability, condensation of chromatin and progression through mitosis.
Notification