-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PBR/TSPO was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human PBR/PBR/TSPO (NP_000705.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PBR/TSPO was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human PBR/PBR/TSPO (NP_000705.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10073A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PBR/TSPO |
| Target Synonyms | DBI; IBP; MBR; PBR; PBS; BPBS; BZRP; PKBS; PTBR; mDRC; pk18; TSPO1; PBR/TSPO | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human PBR/PBR/TSPO (NP_000705.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLG | Uniprot ID | P30536 |
Uniprot Id
P30536
Target Species
Human
Target Name
TSPO
Target Full Name
Translocator protein
Target Function
Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides.
Target Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Target Protein Families
TspO/BZRP family
Target Tissue Specificity
Found in many tissue types. Expressed at the highest levels under normal conditions in tissues that synthesize steroids.
Target Synonyms
TSPO; BZRP; MBR; Translocator protein; Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR
Target Background
Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein.
Notification