Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCDHA13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-360 of human PCDHA13 (NP_061727.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PCDHA13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-360 of human PCDHA13 (NP_061727.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02487A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PCDHA13 |
| Target Synonyms | CNR5; CNRN5; CNRS5; CRNR5; PCDH-ALPHA13; PCDHA13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-360 of human PCDHA13 (NP_061727.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEIRTKGKLDFEEKKLYEISVEAVDKGNIPMAGHCTLLVEVLDVNDNAPEVTITSLSLPIR | Uniprot ID | Q9Y5I0 |
Uniprot Id
Q9Y5I0
Target Synonyms
CNR5; CNRN5; CNRS5; CRNR5; PCDH-ALPHA13; PCDHA13
Target Background
This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
