-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCDHB16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-90 of human PCDHB16 (NP_066008.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PCDHB16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-90 of human PCDHB16 (NP_066008.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05013A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PCDHB16 |
| Target Synonyms | ME1; PCDH3X; PCDHB8a; PCDH-BETA16; PCDHB16 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-90 of human PCDHB16 (NP_066008.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELGSYSVVEETERGSFVANLGKDLGLGLTEMSTRKARIISQGNKQHLQLKAQTGDLLINEKL | Uniprot ID | Q9NRJ7 |
Uniprot Id
Q9NRJ7
Target Species
Human
Target Name
PCDHB16
Target Full Name
Protocadherin beta-16
Target Function
Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Synonyms
Cadherin ME1; KIAA1621; ME 1; ME1; PCDBG_HUMAN; PCDH 3X; PCDH beta16; PCDH-beta-16; PCDH3X; PCDHB 16; PCDHB 8a; PCDHB16; PCDHB8a; PCDHbeta 16; Protocadherin 3x; Protocadherin beta 16; Protocadherin beta 8a; Protocadherin beta-16; Protocadherin-3X; Protocadherin3x
Target Background
This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections.
Notification