-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1921-2025 of human NINJ1 (NP_006188.4?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PCM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1921-2025 of human NINJ1 (NP_006188.4?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08553A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PCM1 |
| Target Synonyms | PTC4; RET/PCM-1; PCM1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1921-2025 of human NINJ1 (NP_006188.4?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VKSAQETPESSLAGSPDTESPVLVNDYEAESGNISQKSDEEDFVKVEDLPLKLTIYSEADLRKKMVEEEQKNHLSGEICEMQTEELAGNSETLKEPETVGAQSI | Uniprot ID | Q15154 |
Uniprot Id
Q15154
Target Species
Human
Target Name
PCM1
Target Full Name
Pericentriolar material 1 protein
Target Function
Required for centrosome assembly and function. Essential for the correct localization of several centrosomal proteins including CEP250, CETN3, PCNT and NEK2. Required to anchor microtubules to the centrosome. Involved in the biogenesis of cilia.
Target Involvement
A chromosomal aberration involving PCM1 is found in papillary thyroid carcinomas (PTCs). Translocation t(8;10)(p21.3;q11.2) with RET links the protein kinase domain of RET to the major portion of PCM1.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasmic granule. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Cytoplasm, cytoskeleton, cilium basal body. Note=Recruitment to the centrosome requires microtubules and dynein. The majority of the protein dissociates from the centrosome during metaphase and subsequently localizes to the cleavage site in telophase. Displaced from centriolar satellites and centrosome in response to cellular stress, such as ultraviolet light (UV) radiation or heat shock, in a process that requires p38 MAP kinase signaling.
Target Protein Families
PCM1 family
Target Tissue Specificity
Expressed in blood, bone marrow, breast, lymph node, ovary and thyroid.
Target Synonyms
hPCM-1; PCM-1; pcm1; PCM1_HUMAN; Pericentriolar material 1; Pericentriolar material 1 protein; PTC4
Target Background
The protein encoded by this gene is a component of centriolar satellites, which are electron dense granules scattered around centrosomes. Inhibition studies show that this protein is essential for the correct localization of several centrosomal proteins, and for anchoring microtubules to the centrosome. Chromosomal aberrations involving this gene are associated with papillary thyroid carcinomas and a variety of hematological malignancies, including atypical chronic myeloid leukemia and T-cell lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification