-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDE5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human PDE5A (NP_001074.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDE5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human PDE5A (NP_001074.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02828A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDE5A |
| Target Synonyms | CN5A; PDE5; CGB-PDE; PDE5A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, A-549, HT-1080, Mouse brain, Mouse skeletal muscle, Rat skeletal muscle, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human PDE5A (NP_001074.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCS | Uniprot ID | O76074 |
Uniprot Id
O76074
Target Species
Human
Target Name
PDE5A
Target Full Name
cGMP-specific 3',5'-cyclic phosphodiesterase
Target Function
Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Specifically regulates nitric-oxide-generated cGMP.
Target Protein Families
Cyclic nucleotide phosphodiesterase family
Target Tissue Specificity
Expressed in aortic smooth muscle cells, heart, placenta, skeletal muscle and pancreas and, to a much lesser extent, in brain, liver and lung.
Target Synonyms
5''-cyclic phosphodiesterase; CGB PDE; CGB-PDE; CGBPDE; cGMP binding cGMP specific 3' 5' cyclic nucleotide phosphodiesterase; cGMP binding cGMP specific 35 cyclic nucleotide phosphodiesterase ; cGMP binding cGMP specific phosphodiesterase; cGMP binding/cGMP specific phosphodiesterase ; cGMP specific 3'5' cyclic phosphodiesterase ; cGMP specific phosphodiesterase PDE5A2; cGMP specific phosphodiesterase type 5A; cGMP-binding cGMP-specific phosphodiesterase; cGMP-specific 3''; CN5A; CN5N; PDE 5; PDE 5A; PDE5; Pde5a; PDE5A_HUMAN; PDE5A1; Phosphodiesterase 5A; Phosphodiesterase 5A cGMP specific; Phosphodiesterase isozyme 5
Target Background
This gene encodes a cGMP-binding, cGMP-specific phosphodiesterase, a member of the cyclic nucleotide phosphodiesterase family. This phosphodiesterase specifically hydrolyzes cGMP to 5'-GMP. It is involved in the regulation of intracellular concentrations of cyclic nucleotides and is important for smooth muscle relaxation in the cardiovascular system. Alternative splicing of this gene results in three transcript variants encoding distinct isoforms.
Notification