-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDE7A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-456 of human PDE7A (NP_002594.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDE7A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-456 of human PDE7A (NP_002594.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05286A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDE7A |
| Target Synonyms | HCP1; PDE7; PDE7A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Jurkat, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 345-456 of human PDE7A (NP_002594.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS | Uniprot ID | Q13946 |
Uniprot Id
Q13946
Target Species
Human
Target Name
PDE7A
Target Full Name
High affinity 3',5'-cyclic-AMP phosphodiesterase 7A
Target Function
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction.
Target Subcellular Location
[Isoform PDE7A1]: Cytoplasm, cytosol. Note=PDE7A1 (57 kDa) is located mostly to soluble cellular fractions.; [Isoform PDE7A2]: Cytoplasm. Note=PDE7A2 (50 kDa) is located to particulate cellular fractions.
Target Protein Families
Cyclic nucleotide phosphodiesterase family, PDE7 subfamily
Target Tissue Specificity
PDE7A1 is found at high levels in skeletal muscle and at low levels in a variety of tissues including brain and heart. It is expressed as well in two T-cell lines. PDE7A2 is found abundantly in skeletal muscle and at low levels in heart.
Target Synonyms
5''-cyclic phosphodiesterase 7A; HCP 1; HCP1; High affinity cAMP specific 3'5' cyclic phosphodiesterase 7A; High affinity cAMP-specific 3''; P2A; PDE 7; PDE 7A; PDE1/PDE2 yeast human complement of; PDE7; PDE71; PDE7A; PDE7A_HUMAN; Phosphodiesterase 7A; Phosphodiesterase isozyme 7; Phosphodiesterase7A; Rolipram insensitive phosphodiesterase type 7 ; TM 22; TM22
Notification