-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDHB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 260-359 of human Pyruvate Dehydrogenase E1 beta subunit (P11177) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PDHB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 260-359 of human Pyruvate Dehydrogenase E1 beta subunit (P11177) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16793A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDHB |
| Target Synonyms | PDHBD; PHE1B; E1beta; PDHE1B; PDHE1-B; PDHB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, 293T, K-562, Mouse liver, Mouse skeletal muscle, Rat kidney, Rat skeletal muscle, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 260-359 of human Pyruvate Dehydrogenase E1 beta subunit (P11177). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI | Uniprot ID | P11177 |
Uniprot Id
P11177
Target Species
Human
Target Name
PDHB
Target Full Name
Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
Target Function
The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.
Target Involvement
Pyruvate dehydrogenase E1-beta deficiency (PDHBD)
Target Subcellular Location
Mitochondrion matrix.
Target Research Area
Cancer
Target Synonyms
DKFZp564K0164; mitochondrial; ODPB_HUMAN; pdhB; PDHBD; PDHE1 B; PDHE1-B; PHE1B; Pyruvate dehydrogenase (lipoamide) beta; Pyruvate dehydrogenase E1 beta polypeptide; Pyruvate dehydrogenase E1 component subunit beta; Pyruvate dehydrogenase E1 component subunit beta mitochondrial
Target Background
The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and carbon dioxide, and provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle. The PDH complex is composed of multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3). The E1 enzyme is a heterotetramer of two alpha and two beta subunits. This gene encodes the E1 beta subunit. Mutations in this gene are associated with pyruvate dehydrogenase E1-beta deficiency. Alternatively spliced transcript variants have been found for this gene.
Notification