-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 308-407 of human PDK2 (Q15119) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PDK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 308-407 of human PDK2 (Q15119) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16075A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDK2 |
| Target Synonyms | PDHK2; PDKII; PDK2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 308-407 of human PDK2 (Q15119). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS | Uniprot ID | Q15119 |
Uniprot Id
Q15119
Target Species
Human
Target Name
PDK2
Target Full Name
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial
Target Function
Kinase that plays a key role in the regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Inhibition of pyruvate dehydrogenase decreases glucose utilization and increases fat metabolism. Mediates cellular responses to insulin. Plays an important role in maintaining normal blood glucose levels and in metabolic adaptation to nutrient availability. Via its regulation of pyruvate dehydrogenase activity, plays an important role in maintaining normal blood pH and in preventing the accumulation of ketone bodies under starvation. Plays a role in the regulation of cell proliferation and in resistance to apoptosis under oxidative stress. Plays a role in p53/TP53-mediated apoptosis.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
PDK/BCKDK protein kinase family
Target Tissue Specificity
Expressed in many tissues, with the highest level in heart and skeletal muscle, intermediate levels in brain, kidney, pancreas and liver, and low levels in placenta and lung.
Target Synonyms
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2; mitochondrial; PDHK2; PDK2; PDK2_HUMAN; Pyruvate dehydrogenase kinase isoform 2; Pyruvate dehydrogenase kinase, isozyme 2; Pyruvate dehydrogenase lipoamide kinase isozyme 2, mitochondrial
Target Background
This gene encodes a member of the pyruvate dehydrogenase kinase family. The encoded protein phosphorylates pyruvate dehydrogenase, down-regulating the activity of the mitochondrial pyruvate dehydrogenase complex. Overexpression of this gene may play a role in both cancer and diabetes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification