Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDLIM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-230 of human PDLIM3 (NP_001107579.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDLIM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-230 of human PDLIM3 (NP_001107579.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11803A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDLIM3 |
| Target Synonyms | ALP; PDLIM3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-230 of human PDLIM3 (NP_001107579.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KAAAHQLCLKIDRGETHLWSPQVSEDGKAHPFKINLESEPQEFKPIGTAHNRRAQPFVAAANIDDKRQVVSASYNSPIGLYSTSNIQDALHGQLRGLIPSSPQNEPTASVPPESDVYRMLHDNRNEPTQPRQSGSFRVLQGMVDDGSDDRPAGTRSVRAPV | Uniprot ID | Q53GG5 |
Uniprot Id
Q53GG5
Target Species
Human
Target Name
PDLIM3
Target Full Name
PDZ and LIM domain protein 3
Target Function
May play a role in the organization of actin filament arrays within muscle cells.
Target Subcellular Location
Cytoplasm, myofibril, sarcomere, Z line. Note=Localizes to myofiber Z-lines.
Target Tissue Specificity
Isoform 1 is highly expressed in differentiated skeletal muscle. Isoform 2 is heart-specific.
Target Research Area
Signal Transduction
Target Synonyms
Actinin associated LIM protein; Actinin-associated LIM protein; Alpha actinin 2 associated LIM protein; Alpha-actinin-2-associated LIM protein; DKFZp686L0362; Enigma homolog; PDLI3_HUMAN; PDLIM 3; PDLIM3; PDZ and LIM domain 3; PDZ and LIM domain protein 3
Target Background
The protein encoded by this gene contains a PDZ domain and a LIM domain, indicating that it may be involved in cytoskeletal assembly. In support of this, the encoded protein has been shown to bind the spectrin-like repeats of alpha-actinin-2 and to colocalize with alpha-actinin-2 at the Z lines of skeletal muscle. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Aberrant alternative splicing of this gene may play a role in myotonic dystrophy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
