-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 72-260 of human PDP1 (NP_060914.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PDP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 72-260 of human PDP1 (NP_060914.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05577A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDP1 |
| Target Synonyms | PDH; PDP; PDPC; PPM2A; PPM2C; PDP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, 293T, 5637, DU145, Mouse brain, Mouse skeletal muscle, Rat skeletal muscle, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 72-260 of human PDP1 (NP_060914.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLEAQVGDPNSFL | Uniprot ID | Q9P0J1 |
Uniprot Id
Q9P0J1
Target Species
Human
Target Name
PDP1
Target Full Name
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
Target Function
Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.
Target Involvement
Pyruvate dehydrogenase phosphatase deficiency (PDP deficiency)
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
PP2C family
Target Synonyms
[Pyruvate dehydrogenase [acetyl transferring]] phosphatase 1; mitochondrial; [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1; FLJ32517; Gm1024; MGC119646 ; mitochondrial; PDH; PDP 1; PDP; Pdp1; PDP1_HUMAN; PDPC 1; PDPC; PPM2C; Protein phosphatase 2C; protein phosphatase 2C; magnesium dependent; catalytic subunit; Pyruvate dehydrogenase (Lipoamide) phosphatase phosphatase; Pyruvate dehydrogenase phosphatase catalytic subunit 1; Pyruvate dehydrogenase phosphatase; catalytic subunit 1; RP23 203A12.1
Target Background
Pyruvate dehydrogenase (E1) is one of the three components (E1, E2, and E3) of the large pyruvate dehydrogenase complex. Pyruvate dehydrogenase kinases catalyze phosphorylation of serine residues of E1 to inactivate the E1 component and inhibit the complex. Pyruvate dehydrogenase phosphatases catalyze the dephosphorylation and activation of the E1 component to reverse the effects of pyruvate dehydrogenase kinases. Pyruvate dehydrogenase phosphatase is a heterodimer consisting of catalytic and regulatory subunits. Two catalytic subunits have been reported; one is predominantly expressed in skeletal muscle and another one is is much more abundant in the liver. The catalytic subunit, encoded by this gene, is the former, and belongs to the protein phosphatase 2C (PP2C) superfamily. Along with the pyruvate dehydrogenase complex and pyruvate dehydrogenase kinases, this enzyme is located in the mitochondrial matrix. Mutation in this gene causes pyruvate dehydrogenase phosphatase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Notification