-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PEA15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEA15 (NP_003759.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PEA15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEA15 (NP_003759.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00849A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PEA15 |
| Target Synonyms | PED; MAT1; HMAT1; MAT1H; PEA-15; HUMMAT1H; PED-PEA15; PED/PEA15; PEA15 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, A375, HepG2, Mouse liver, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEA15 (NP_003759.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA | Uniprot ID | Q15121 |
Uniprot Id
Q15121
Target Species
Human
Target Name
PEA15
Target Full Name
Astrocytic phosphoprotein PEA-15
Target Function
Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm. Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface.
Target Subcellular Location
Cytoplasm. Note=Associated with microtubules.
Target Tissue Specificity
Ubiquitously expressed. Most abundant in tissues such as heart, brain, muscle and adipose tissue which utilize glucose as an energy source. Lower expression in glucose-producing tissues. Higher levels of expression are found in tissues from individuals wi
Target Research Area
Cell Biology
Target Synonyms
15 kDa phosphoprotein enriched in astrocytes; Astrocytic phosphoprotein PEA 15; Astrocytic phosphoprotein PEA-15; Astrocytic phosphoprotein PEA15; HMAT 1; HMAT1; Homolog of mouse MAT 1 oncogene; Homolog of mouse MAT1 oncogene; HUMMAT 1H; HUMMAT1H; MAT 1; MAT 1H; MAT1; MAT1H; PEA 15; Pea15; PEA15 protein; PEA15_HUMAN; PED; Phosphoprotein enriched in astrocytes 15; Phosphoprotein enriched in astrocytes 15kD; Phosphoprotein enriched in diabetes
Target Background
This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Alternative splicing results in multiple transcript variants.
Notification