-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PEDF/SERPINF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 141-240 of human PEDF/SERPINF1 (NP_002606.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PEDF/SERPINF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 141-240 of human PEDF/SERPINF1 (NP_002606.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00551A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PEDF/SERPINF1 |
| Target Synonyms | OI6; OI12; PEDF; EPC-1; PIG35; PEDF/SERPINF1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, human serum, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 141-240 of human PEDF/SERPINF1 (NP_002606.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVR | Uniprot ID | P36955 |
Uniprot Id
P36955
Target Species
Human
Target Name
SERPINF1
Target Full Name
Pigment epithelium-derived factor
Target Function
Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
Target Involvement
Osteogenesis imperfecta 6 (OI6)
Target Subcellular Location
Secreted. Melanosome. Note=Enriched in stage I melanosomes.
Target Protein Families
Serpin family
Target Tissue Specificity
Retinal pigment epithelial cells and blood plasma.
Target Synonyms
Cell proliferation-inducing gene 35 protein; EPC 1; EPC-1; EPC1; OI12; OI6; PEDF; PEDF_HUMAN; PIG 35; PIG35; Pigment epithelium derived factor; Pigment epithelium-derived factor; Proliferation inducing protein 35; Serine (or cysteine) proteinase inhibitor; serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; Serpin F1; Serpin family F member 1; Serpin peptidase inhibitor; Serpin peptidase inhibitor clade F member 1; serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; SERPINF 1; Serpinf1
Target Background
This gene encodes a member of the serpin family that does not display the serine protease inhibitory activity shown by many of the other serpin proteins. The encoded protein is secreted and strongly inhibits angiogenesis. In addition, this protein is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells. Mutations in this gene were found in individuals with osteogenesis imperfecta, type VI.
Notification