Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PEPCK/PCK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 550-640 of human PEPCK/PEPCK/PCK2 (Q16822) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PEPCK/PCK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 550-640 of human PEPCK/PEPCK/PCK2 (Q16822) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-17180A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PEPCK/PCK2 |
| Target Synonyms | PEPCK; PEPCK2; PEPCK-M; K2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Hep G2, Mouse brain, Mouse lung, Mouse spleen, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 550-640 of human PEPCK/PEPCK/PCK2 (Q16822). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM | Uniprot ID | Q16822 |
Uniprot Id
Q16822
Target Species
Human
Target Name
PCK2
Target Full Name
Phosphoenolpyruvate carboxykinase [GTP], mitochondrial
Target Function
Catalyzes the conversion of oxaloacetate (OAA) to phosphoenolpyruvate (PEP), the rate-limiting step in the metabolic pathway that produces glucose from lactate and other precursors derived from the citric acid cycle.
Target Involvement
Mitochondrial phosphoenolpyruvate carboxykinase deficiency (M-PEPCKD)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Phosphoenolpyruvate carboxykinase [GTP] family
Target Synonyms
EC 4.1.1.32; GTP mitochondrial precursor; HGNC:8725; mitochondrial; Mitochondrial phosphoenolpyruvate carboxykinase 2; OTTHUMP00000164700; PCK2; PCKGM_HUMAN; PE ; PEP carboxykinase; PEPCK; PEPCK deficiency mitochondrial; PEPCK M; PEPCK-M; PEPCK2; Phosphoenolpyruvate carboxykinase [GTP]; Phosphoenolpyruvate carboxykinase 2 (mitochondrial); Phosphoenolpyruvate carboxykinase 2 mitochondrial; Phosphoenolpyruvate carboxylase; Phosphopyruvate carboxylase
Target Background
This gene encodes a mitochondrial enzyme that catalyzes the conversion of oxaloacetate to phosphoenolpyruvate in the presence of guanosine triphosphate (GTP). A cytosolic form of this protein is encoded by a different gene and is the key enzyme of gluconeogenesis in the liver. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
