-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PERK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-600 of human PERK(NP_004827.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against PERK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-600 of human PERK(NP_004827.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-08447A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PERK |
| Target Synonyms | PEK; WRS; PERK | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-600 of human PERK(NP_004827.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIVRRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLG | Uniprot ID | Q9NZJ5 |
Uniprot Id
Q9NZJ5
Target Species
Human
Target Name
EIF2AK3
Target Full Name
Eukaryotic translation initiation factor 2-alpha kinase 3
Target Function
Metabolic-stress sensing protein kinase that phosphorylates the alpha subunit of eukaryotic translation initiation factor 2 (EIF2S1/eIF-2-alpha) in response to various stress conditions. Key activator of the integrated stress response (ISR) required for adaptation to various stress, such as unfolded protein response (UPR) and low amino acid availability. EIF2S1/eIF-2-alpha phosphorylation in response to stress converts EIF2S1/eIF-2-alpha in a global protein synthesis inhibitor, leading to a global attenuation of cap-dependent translation, while concomitantly initiating the preferential translation of ISR-specific mRNAs, such as the transcriptional activators ATF4 and QRICH1, and hence allowing ATF4- and QRICH1-mediated reprogramming. Serves as a critical effector of unfolded protein response (UPR)-induced G1 growth arrest due to the loss of cyclin-D1 (CCND1). Involved in control of mitochondrial morphology and function.
Target Involvement
Wolcott-Rallison syndrome (WRS)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, GCN2 subfamily
Target Tissue Specificity
Ubiquitous. A high level expression is seen in secretory tissues.
Target Synonyms
DKFZp781H1925; E2AK3_HUMAN; EC 2.7.11.1; Eif2ak3; Eukaryotic translation initiation factor 2 alpha kinase 3; Eukaryotic translation initiation factor 2-alpha kinase 3; Heme regulated EIF2 alpha kinase; HRI ; HsPEK; Pancreatic eIF2 alpha kinase; Pancreatic eIF2-alpha kinase; PEK; PRKR like endoplasmic reticulum kinase; PRKR-like endoplasmic reticulum kinase; WRS
Target Background
The protein encoded by this gene phosphorylates the alpha subunit of eukaryotic translation-initiation factor 2, leading to its inactivation, and thus to a rapid reduction of translational initiation and repression of global protein synthesis. This protein is thought to modulate mitochondrial function. It is a type I membrane protein located in the endoplasmic reticulum (ER), where it is induced by ER stress caused by malfolded proteins. Mutations in this gene are associated with Wolcott-Rallison syndrome.
Notification