-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Peroxiredoxin 3 (PRDX3) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 157-256 of human Peroxiredoxin 3 (PRDX3) (PRDX3) (P30048) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Peroxiredoxin 3 (PRDX3) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 157-256 of human Peroxiredoxin 3 (PRDX3) (PRDX3) (P30048) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13787A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Peroxiredoxin 3 (PRDX3) |
| Target Synonyms | AOP1; MER5; AOP-1; PPPCD; SP-22; HBC189; SCAR32; PRO1748; prx-III; Peroxiredoxin 3 (PRDX3) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, MCF7, Mouse liver, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 157-256 of human Peroxiredoxin 3 (PRDX3) (PRDX3) (P30048). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ | Uniprot ID | P30048 |
Uniprot Id
P30048
Target Species
Human
Target Name
PRDX3
Target Full Name
Thioredoxin-dependent peroxide reductase, mitochondrial
Target Function
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. Acts synergistically with MAP3K13 to regulate the activation of NF-kappa-B in the cytosol.
Target Subcellular Location
Mitochondrion. Cytoplasm. Early endosome.
Target Protein Families
Peroxiredoxin family, AhpC/Prx1 subfamily
Target Research Area
Cancer
Target Synonyms
Antioxidant protein 1; AOP 1; AOP-1; AOP1; HBC189; MER5; MGC104387; MGC24293; mitochondrial; peroxiredoxin 3; Peroxiredoxin III; Peroxiredoxin-3; PRDX3; PRDX3_HUMAN; PRO1748; Protein MER5 homolog; PRX III; Prx-III; PRX3; SP 22; SP-22; SP22; Thioredoxin dependent peroxide reductase mitochondrial; Thioredoxin-dependent peroxide reductase
Target Background
This gene encodes a mitochondrial protein with antioxidant function. The protein is similar to the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase, and it can rescue bacterial resistance to alkylhydroperoxide in E. coli that lack the C22 subunit. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologs suggest that these genes consist of a family that is responsible for the regulation of cellular proliferation, differentiation and antioxidant functions. This family member can protect cells from oxidative stress, and it can promote cell survival in prostate cancer. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 3, 13 and 22.
Notification