-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Peroxiredoxin 6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 125-224 of human Peroxiredoxin 6 (NP_004896.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Peroxiredoxin 6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 125-224 of human Peroxiredoxin 6 (NP_004896.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13848A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Peroxiredoxin 6 |
| Target Synonyms | PRX; p29; AOP2; 1-Cys; NSGPx; aiPLA2; LPCAT-5; HEL-S-128m; Peroxiredoxin 6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, Mouse liver, Rat kidney, Rat liver, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 125-224 of human Peroxiredoxin 6 (NP_004896.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP | Uniprot ID | P30041 |
Uniprot Id
P30041
Target Species
Human
Target Name
PRDX6
Target Full Name
Peroxiredoxin-6
Target Function
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. Also has phospholipase activity, can therefore either reduce the oxidized sn-2 fatty acyl group of phospholipids (peroxidase activity) or hydrolyze the sn-2 ester bond of phospholipids (phospholipase activity). These activities are dependent on binding to phospholipids at acidic pH and to oxidized phospholipds at cytosolic pH. Plays a role in cell protection against oxidative stress by detoxifying peroxides and in phospholipid homeostasis. Exhibits acyl-CoA-dependent lysophospholipid acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC). Shows a clear preference for LPC as the lysophospholipid and for palmitoyl CoA as the fatty acyl substrate.
Target Subcellular Location
Cytoplasm. Lysosome.
Target Protein Families
Peroxiredoxin family, Prx6 subfamily
Target Synonyms
1 Cys; 1 Cys peroxiredoxin; 1 Cys PRX; 1 cysPrx; 1-Cys peroxiredoxin; 1-Cys PRX; 24 kDa protein; 9430088D19Rik ; AA690119; Acidic calcium independent phospholipase A2 ; Acidic calcium-independent phospholipase A2; aiPLA2; Antioxidant protein 2; AOP2; Aop2 rs3; Brp 12; Ciliary body glutathione peroxidase ; CP 3; EC 1.11.1.15; EC 1.11.1.7 ; EC 3.1.1.; Epididymis secretory sperm binding protein Li 128m; GPx ; HEL S 128m; KIAA0106; Liver 2D page spot 40; Ltw4; Lvtw 4; MGC46173; mKIAA0106; Non selenium glutathione peroxidase; Non-selenium glutathione peroxidase; NSGPx; ORF06; OTTHUMP00000032693 ; p29; Peroxiredoxin-6; Peroxiredoxin6; PHGPx; Phospholipase A2 lysosomal ; PLA2; PRDX 6; Prdx5; PRDX6; Prdx6 rs3; PRDX6_HUMAN; PRX; Red blood cells page spot 12; Thiol specific antioxidant protein
Target Background
The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.
Notification