Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PEX11A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-180 of human PEX11A (NP_003838.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PEX11A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-180 of human PEX11A (NP_003838.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06953A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PEX11A |
| Target Synonyms | PMP28; hsPEX11p; PEX11alpha; PEX11-ALPHA; PEX11A | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-180 of human PEX11A (NP_003838.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTSGINKEKWRTRAAHHYYYSLLLSLVRDLYEISLQMKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSF | Uniprot ID | O75192 |
Uniprot Id
O75192
Target Species
Human
Target Name
PEX11A
Target Full Name
Peroxisomal membrane protein 11A
Target Function
May be involved in peroxisomal proliferation and may regulate peroxisomes division. May mediate binding of coatomer proteins to the peroxisomal membrane. Promotes membrane protrusion and elongation on the peroxisomal surface.
Target Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Target Protein Families
Peroxin-11 family
Target Synonyms
PEX11A; PEX11; Peroxisomal membrane protein 11A; HsPEX11p; 28 kDa peroxisomal integral membrane protein; PMP28; Peroxin-11A; Peroxisomal biogenesis factor 11A; Protein PEX11 homolog alpha; PEX11-alpha
Target Background
This gene is a member of the PEX11 family, which is composed of membrane elongation factors involved in regulation of peroxisome maintenance and proliferation. This gene product interacts with peroxisomal membrane protein 19 and may respond to outside stimuli to increase peroxisome abundance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
