Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PEX11B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human PEX11B (NP_003837.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PEX11B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human PEX11B (NP_003837.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01713A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PEX11B |
| Target Synonyms | PEX14B; PEX11beta; PEX11-BETA; PEX11B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, HepG2, Mouse brain, Rat lung, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human PEX11B (NP_003837.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG | Uniprot ID | O96011 |
Uniprot Id
O96011
Target Species
Human
Target Name
PEX11B
Target Full Name
Peroxisomal membrane protein 11B
Target Function
Involved in peroxisomal proliferation. May regulate peroxisome division by recruiting the dynamin-related GTPase DNM1L to the peroxisomal membrane. Promotes membrane protrusion and elongation on the peroxisomal surface.
Target Involvement
Peroxisome biogenesis disorder 14B (PBD14B)
Target Subcellular Location
Peroxisome membrane; Single-pass membrane protein.
Target Protein Families
Peroxin-11 family
Target Synonyms
PEX11B; Peroxisomal membrane protein 11B; Peroxin-11B; Peroxisomal biogenesis factor 11B; Protein PEX11 homolog beta; PEX11-beta
Target Background
The protein encoded by this gene facilitates peroxisomal proliferation and interacts with PEX19. The encoded protein is found in the peroxisomal membrane. Several transcript variants, some protein-coding and some not protein-coding, have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
