Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PFDN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human PFDN2 (NP_036526.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PFDN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human PFDN2 (NP_036526.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09274A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PFDN2 |
| Target Synonyms | PFD2; PFDN2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, 22Rv1, 293T, Jurkat, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human PFDN2 (NP_036526.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS | Uniprot ID | Q9UHV9 |
Uniprot Id
Q9UHV9
Target Species
Human
Target Name
PFDN2
Target Full Name
Prefoldin subunit 2
Target Function
Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
Target Subcellular Location
Nucleus. Cytoplasm. Mitochondrion.
Target Protein Families
Prefoldin subunit beta family
Target Synonyms
OTTHUMP00000029707; PFD2; PFD2_HUMAN; PFDN2; prefoldin 2; Prefoldin subunit 2
Target Background
This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
