-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PFDN5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-154 of human PFDN5 (Q99471) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PFDN5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-154 of human PFDN5 (Q99471) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14309A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PFDN5 |
| Target Synonyms | MM1; MM-1; PFD5; PFDN5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Jurkat, Mouse lung, Mouse spleen, Mouse testis, Rat lung, Rat spleen, Rat testis, RD | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-154 of human PFDN5 (Q99471). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA | Uniprot ID | Q99471 |
Uniprot Id
Q99471
Target Species
Human
Target Name
PFDN5
Target Full Name
Prefoldin subunit 5
Target Function
Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC.
Target Subcellular Location
[Isoform 1]: Nucleus.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Nucleus.
Target Protein Families
Prefoldin subunit alpha family
Target Tissue Specificity
Highly expressed in pancreas and skeletal muscle and moderately in other tissues.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
1190001O17Rik; 1700010A06Rik; c myc binding protein; c-myc binding protein MM 1; C-myc-binding protein Mm-1; D15Ertd697e; EIG 1; Eig1; MGC5329; MGC71907; MM 1; MM1; Myc modulator 1; PFD5; PFD5_HUMAN; PFDN5; Prefoldin 5; Prefoldin subunit 5
Target Background
This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification