Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PFKFB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 446-505 of human PFKFB2 (NP_006203.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PFKFB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 446-505 of human PFKFB2 (NP_006203.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08924A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PFKFB2 |
| Target Synonyms | PFK-2/FBPase-2; PFKFB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse brain, Mouse liver, Mouse skeletal muscle, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 446-505 of human PFKFB2 (NP_006203.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD | Uniprot ID | O60825 |
Uniprot Id
O60825
Target Species
Human
Target Name
PFKFB2
Target Full Name
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
Target Function
Synthesis and degradation of fructose 2,6-bisphosphate.
Target Protein Families
Phosphoglycerate mutase family
Target Tissue Specificity
Heart.
Target Synonyms
6 phosphofructo 2 kinase/fructose 2 6 biphosphatase 2 ; 6-bisphosphatase; 6-P2ase 2; 6-P2ASE heart-type isozyme; 6PF 2 K/Fru 2 6 P2ASE heart type isozyme; 6PF-2-K/Fru-2; 6PF-2-K/Fru-26-P2ase 2; 6PF-2-K/Fru-26-P2ase heart-type isozyme; F262_HUMAN; Fructose 2 6 bisphosphatase cardiac isozyme; Fructose-2; PFK 2/FBPase 2; PFK/FBPase 2; PFKFB cardiac ; PFKFB2
Target Background
The protein encoded by this gene is involved in both the synthesis and degradation of fructose-2, 6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2, 6-bisphosphate, and a fructose-2, 6-biphosphatase activity that catalyzes the degradation of fructose-2, 6-bisphosphate. This protein regulates fructose-2, 6-bisphosphate levels in the heart, while a related enzyme encoded by a different gene regulates fructose-2, 6-bisphosphate levels in the liver and muscle. This enzyme functions as a homodimer. Two transcript variants encoding two different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
