Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGAM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-146 of human PGAM5 (NP_001164014.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PGAM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-146 of human PGAM5 (NP_001164014.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10732A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGAM5 |
| Target Synonyms | BXLBV68; PGAM5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, MCF7 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-146 of human PGAM5 (NP_001164014.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV | Uniprot ID | Q96HS1 |
Uniprot Id
Q96HS1
Target Species
Human
Target Name
PGAM5
Target Full Name
Serine/threonine-protein phosphatase PGAM5, mitochondrial
Target Function
Displays phosphatase activity for serine/threonine residues, and, dephosphorylates and activates MAP3K5 kinase. Has apparently no phosphoglycerate mutase activity. May be regulator of mitochondrial dynamics. Substrate for a KEAP1-dependent ubiquitin ligase complex. Contributes to the repression of NFE2L2-dependent gene expression. Acts as a central mediator for programmed necrosis induced by TNF, by reactive oxygen species and by calcium ionophore.
Target Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Note=Isoform 2 overexpression results in the formation of disconnected punctuate mitochondria distributed throughout the cytoplasm. Isoform 1 overexpression results in the clustering of mitochondria around the nucleus.
Target Protein Families
Phosphoglycerate mutase family, BPG-dependent PGAM subfamily
Target Research Area
Cancer
Target Synonyms
Bcl-XL-binding protein v68; BXLBv68; MGC5352; mitochondrial; PGAM5; PGAM5_HUMAN; Phosphoglycerate mutase family member 5; Serine/threonine protein phosphatase PGAM5 mitochondrial; Serine/threonine-protein phosphatase PGAM5
Target Background
Enables GTPase activator activity and protein serine/threonine phosphatase activity. Involved in necroptotic process. Located in mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
