-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGC1 beta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 924-1023 of human PGC1 beta (NP_573570.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PGC1 beta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 924-1023 of human PGC1 beta (NP_573570.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14300A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGC1 beta |
| Target Synonyms | PERC; ERRL1; PGC1B; PGC-1(beta); PGC1 beta | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat testis, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 924-1023 of human PGC1 beta (NP_573570.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH | Uniprot ID | Q86YN6 |
Uniprot Id
Q86YN6
Target Species
Human
Target Name
PPARGC1B
Target Full Name
Peroxisome proliferator-activated receptor gamma coactivator 1-beta
Target Function
Plays a role of stimulator of transcription factors and nuclear receptors activities. Activates transcriptional activity of estrogen receptor alpha, nuclear respiratory factor 1 (NRF1) and glucocorticoid receptor in the presence of glucocorticoids. May play a role in constitutive non-adrenergic-mediated mitochondrial biogenesis as suggested by increased basal oxygen consumption and mitochondrial number when overexpressed. May be involved in fat oxidation and non-oxidative glucose metabolism and in the regulation of energy expenditure. Induces the expression of PERM1 in the skeletal muscle in an ESRRA-dependent manner.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Ubiquitous with higher expression in heart, brain and skeletal muscle.
Target Research Area
Others
Target Synonyms
PERC; peroxisome proliferative activated receptor, gamma, coactivator 1,; peroxisome proliferator-activated receptor gamma coactivator 1 beta; Peroxisome proliferator-activated receptor gamma coactivator 1-beta; peroxisome proliferator-activated receptor gamma, coactivator 1 beta ; PGC-1(beta); PGC-1-beta; PGC-1-related estrogen receptor alpha coactivator; PGC1; PPAR gamma coactivator-1beta; PPAR-gamma coactivator 1-beta; PPARGC-1-beta; PPARGC1; Ppargc1b; PRGC2_HUMAN
Target Background
The protein encoded by this gene stimulates the activity of several transcription factors and nuclear receptors, including estrogen receptor alpha, nuclear respiratory factor 1, and glucocorticoid receptor. The encoded protein may be involved in fat oxidation, non-oxidative glucose metabolism, and the regulation of energy expenditure. This protein is downregulated in prediabetic and type 2 diabetes mellitus patients. Certain allelic variations in this gene increase the risk of the development of obesity. Three transcript variants encoding different isoforms have been found for this gene.
Notification