-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGE receptor EP3 (PTGER3) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-53 of human PGE receptor EP3 (PTGER3) (NP_942009.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PGE receptor EP3 (PTGER3) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-53 of human PGE receptor EP3 (PTGER3) (NP_942009.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11231A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGE receptor EP3 (PTGER3) |
| Target Synonyms | EP3; EP3e; EP3-I; EP3-II; EP3-IV; EP3-VI; PGE2-R; EP3-III; lnc003875; PGE receptor EP3 (PTGER3) | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-53 of human PGE receptor EP3 (PTGER3) (NP_942009.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA | Uniprot ID | P43115 |
Uniprot Id
P43115
Target Species
Human
Target Name
PTGER3
Target Full Name
Prostaglandin E2 receptor EP3 subtype
Target Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium. Required for normal development of fever in response to pyrinogens, including IL1B, prostaglandin E2 and bacterial lipopolysaccharide (LPS). Required for normal potentiation of platelet aggregation by prostaglandin E2, and thus plays a role in the regulation of blood coagulation. Required for increased HCO3(-) secretion in the duodenum in response to mucosal acidification, and thereby contributes to the protection of the mucosa against acid-induced ulceration. Not required for normal kidney function, normal urine volume and osmolality.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Detected in kidney. Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels.
Target Research Area
Metabolism
Target Synonyms
PTGER3; Prostaglandin E2 receptor EP3 subtype; PGE receptor EP3 subtype; PGE2 receptor EP3 subtype; PGE2-R; Prostanoid EP3 receptor
Target Background
The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification