-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PGK1 (P00558) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PGK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PGK1 (P00558) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17001A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGK1 |
| Target Synonyms | PGKA; MIG10; HEL-S-68p; PGK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, K-562, Mouse brain, Mouse lung, Rat kidney, Rat ovary | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PGK1 (P00558). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCV | Uniprot ID | P00558 |
Uniprot Id
P00558
Target Species
Human
Target Name
PGK1
Target Full Name
Phosphoglycerate kinase 1
Target Function
Catalyzes one of the two ATP producing reactions in the glycolytic pathway via the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. In addition to its role as a glycolytic enzyme, it seems that PGK-1 acts as a polymerase alpha cofactor protein (primer recognition protein). May play a role in sperm motility.
Target Involvement
Phosphoglycerate kinase 1 deficiency (PGK1D)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Phosphoglycerate kinase family
Target Tissue Specificity
Mainly expressed in spermatogonia. Localized on the principle piece in the sperm (at protein level). Expression significantly decreased in the testis of elderly men.
Target Research Area
Metabolism
Target Synonyms
Cell migration-inducing gene 10 protein; Epididymis secretory sperm binding protein Li 68p; HEL S 68p; MGC117307; MGC8947; MIG10; pgk1; PGK1_HUMAN; PGKA; Phosphoglycerate kinase 1; Primer recognition protein 2; PRP 2
Target Background
The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1, 3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. Additionally, this protein is secreted by tumor cells where it participates in angiogenesis by functioning to reduce disulfide bonds in the serine protease, plasmin, which consequently leads to the release of the tumor blood vessel inhibitor angiostatin. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Deficiency of the enzyme is associated with a wide range of clinical phenotypes hemolytic anemia and neurological impairment. Pseudogenes of this gene have been defined on chromosomes 19, 21 and the X chromosome.
Notification