Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGP9.5/UCHL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 59-223 of human PGP9.5/PGP9.5/UCHL1 (NP_004172.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PGP9.5/UCHL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 59-223 of human PGP9.5/PGP9.5/UCHL1 (NP_004172.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10409A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGP9.5/UCHL1 |
| Target Synonyms | NDGOA; PARK5; PGP95; SPG79; PGP9.5; SPG79A; UCHL-1; Uch-L1; HEL-117; PGP 9.5; HEL-S-53; PGP9.5/UCHL1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse brain, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 59-223 of human PGP9.5/PGP9.5/UCHL1 (NP_004172.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA | Uniprot ID | P09936 |
Uniprot Id
P09936
Target Species
Human
Target Name
UCHL1
Target Full Name
Ubiquitin carboxyl-terminal hydrolase isozyme L1
Target Function
Ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. Also binds to free monoubiquitin and may prevent its degradation in lysosomes. The homodimer may have ATP-independent ubiquitin ligase activity.
Target Involvement
Parkinson disease 5 (PARK5); Spastic paraplegia 79, autosomal recessive (SPG79)
Target Subcellular Location
Cytoplasm. Endoplasmic reticulum membrane; Lipid-anchor. Note=About 30% of total UCHL1 is associated with membranes in brain.
Target Protein Families
Peptidase C12 family
Target Tissue Specificity
Found in neuronal cell bodies and processes throughout the neocortex (at protein level). Expressed in neurons and cells of the diffuse neuroendocrine system and their tumors. Weakly expressed in ovary. Down-regulated in brains from Parkinson disease and A
Target Research Area
Neuroscience
Target Synonyms
Epididymis luminal protein 117; Epididymis secretory protein Li 53; HEL 117; HEL S 53; NDGOA; Neuron cytoplasmic protein 9.5; OTTHUMP00000218137; OTTHUMP00000218139; OTTHUMP00000218140; OTTHUMP00000218141; Park 5; PARK5; PGP 9.5; PGP9.5; PGP95; Protein gene product 9.5; Ubiquitin C terminal esterase L1; Ubiquitin C terminal hydrolase; Ubiquitin C terminal hydrolase L1; Ubiquitin carboxyl terminal esterase L1; Ubiquitin carboxyl terminal hydrolase isozyme L1; Ubiquitin carboxyl-terminal hydrolase isozyme L1; Ubiquitin thioesterase L1; Ubiquitin thiolesterase; Ubiquitin thiolesterase L1; UCH-L1; UCHL1; UCHL1_HUMAN
Target Background
The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
