Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGRMC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-195 of human PGRMC1 (NP_006658.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PGRMC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-195 of human PGRMC1 (NP_006658.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03736A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGRMC1 |
| Target Synonyms | IZA; MPR; Dap1; HPR6.6; PGRMC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Mouse brain, Mouse liver, NCI-H460, OVCAR3, SW480 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 44-195 of human PGRMC1 (NP_006658.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND | Uniprot ID | O00264 |
Uniprot Id
O00264
Target Species
Human
Target Name
PGRMC1
Target Full Name
Membrane-associated progesterone receptor component 1
Target Function
Component of a progesterone-binding protein complex. Binds progesterone. Has many reported cellular functions (heme homeostasis, interaction with CYPs). Required for the maintenance of uterine histoarchitecture and normal female reproductive lifespan. Intracellular heme chaperone. Regulates heme synthesis via interactions with FECH and acts as a heme donor for at least some hemoproteins.
Target Subcellular Location
Microsome membrane; Single-pass membrane protein. Smooth endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane; Single-pass membrane protein; Extracellular side.
Target Protein Families
Cytochrome b5 family, MAPR subfamily
Target Tissue Specificity
Widely expressed, with highest expression in liver and kidney. Expressed by endometrial glands and stroma (at protein level).
Target Synonyms
PGRMC1; HPR6.6; PGRMC; Membrane-associated progesterone receptor component 1; mPR; Dap1; IZA
Target Background
This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
