-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PHF8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human PHF8 (Q9UPP1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PHF8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human PHF8 (Q9UPP1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16239A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PHF8 |
| Target Synonyms | KDM7B; JHDM1F; MRXSSD; ZNF422; PHF8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, C2C12, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human PHF8 (Q9UPP1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGT | Uniprot ID | Q9UPP1 |
Uniprot Id
Q9UPP1
Target Species
Human
Target Name
PHF8
Target Full Name
Histone lysine demethylase PHF8
Target Function
Histone lysine demethylase with selectivity for the di- and monomethyl states that plays a key role cell cycle progression, rDNA transcription and brain development. Demethylates mono- and dimethylated histone H3 'Lys-9' residue (H3K9Me1 and H3K9Me2), dimethylated H3 'Lys-27' (H3K27Me2) and monomethylated histone H4 'Lys-20' residue (H4K20Me1). Acts as a transcription activator as H3K9Me1, H3K9Me2, H3K27Me2 and H4K20Me1 are epigenetic repressive marks. Involved in cell cycle progression by being required to control G1-S transition. Acts as a coactivator of rDNA transcription, by activating polymerase I (pol I) mediated transcription of rRNA genes. Required for brain development, probably by regulating expression of neuron-specific genes. Only has activity toward H4K20Me1 when nucleosome is used as a substrate and when not histone octamer is used as substrate. May also have weak activity toward dimethylated H3 'Lys-36' (H3K36Me2), however, the relevance of this result remains unsure in vivo. Specifically binds trimethylated 'Lys-4' of histone H3 (H3K4me3), affecting histone demethylase specificity: has weak activity toward H3K9Me2 in absence of H3K4me3, while it has high activity toward H3K9me2 when binding H3K4me3
Target Involvement
Mental retardation, X-linked, syndromic, Siderius type (MRXSSD)
Target Subcellular Location
Nucleus. Nucleus, nucleolus.
Target Protein Families
JHDM1 histone demethylase family, JHDM1D subfamily
Target Synonyms
Histone lysine demethylase PHF8; JHDM1F; Jumonji C domain containing histone demethylase 1F; MRXSSD; PHD finger protein 8; PHF8; PHF8_HUMAN; ZNF422
Target Background
The protein encoded by this gene is a histone lysine demethylase that preferentially acts on histones in the monomethyl or dimethyl states. The encoded protein requires Fe(2+) ion, 2-oxoglutarate, and oxygen for its catalytic activity. The protein has an N-terminal PHD finger and a central Jumonji C domain. This gene is thought to function as a transcription activator. Defects in this gene are a cause of syndromic X-linked Siderius type intellectual disability (MRXSSD) and over-expression of this gene is associated with several forms of cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification