-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PHLPP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1250-1323 of human PHLPP2 (NP_055835.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PHLPP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1250-1323 of human PHLPP2 (NP_055835.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11572A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PHLPP2 |
| Target Synonyms | PPM3B; PHLPPL; PHLPP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat eye | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1250-1323 of human PHLPP2 (NP_055835.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSLNLIEVATEVPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFDTAL | Uniprot ID | Q6ZVD8 |
Uniprot Id
Q6ZVD8
Target Species
Human
Target Name
PHLPP2
Target Full Name
PH domain leucine-rich repeat-containing protein phosphatase 2
Target Function
Protein phosphatase involved in regulation of Akt and PKC signaling. Mediates dephosphorylation in the C-terminal domain hydrophobic motif of members of the AGC Ser/Thr protein kinase family; specifically acts on 'Ser-473' of AKT1, 'Ser-660' of PRKCB isoform beta-II and 'Ser-657' of PRKCA. Akt regulates the balance between cell survival and apoptosis through a cascade that primarily alters the function of transcription factors that regulate pro- and antiapoptotic genes. Dephosphorylation of 'Ser-473' of Akt triggers apoptosis and decreases cell proliferation. Also controls the phosphorylation of AKT3. Dephosphorylates STK4 on 'Thr-387' leading to STK4 activation and apoptosis. Dephosphorylates RPS6KB1 and is involved in regulation of cap-dependent translation. Inhibits cancer cell proliferation and may act as a tumor suppressor. Dephosphorylation of PRKCA and PRKCB leads to their destabilization and degradation. Dephosphorylates RAF1 inhibiting its kinase activity
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein. Nucleus. Note=In colorectal cancer tissue, expression is concentrated in the cytoplasm and nucleus.
Target Tissue Specificity
In colorectal cancer tissue, expression is highest in the surface epithelium of normal colonic mucosa adjacent to the cancer tissue but is largely excluded from the crypt bases. Expression is lost or significantly decreased in 80% of tested tumors (at pro
Target Synonyms
KIAA0931; PH domain and leucine rich repeat protein phosphatase 2; PH domain leucine rich repeat protein phosphatase like ; PH domain leucine-rich repeat-containing protein phosphatase 2; PH domain leucine-rich repeat-containing protein phosphatase-like; PHLP2_HUMAN; PHLPP like; PHLPP-like; Phlpp2; PHLPPL
Notification