Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PI15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-170 of human PI15 (NP_056970.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PI15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-170 of human PI15 (NP_056970.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05396A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PI15 |
| Target Synonyms | P24TI; P25TI; CRISP8; PI15 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 61-170 of human PI15 (NP_056970.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMC | Uniprot ID | O43692 |
Uniprot Id
O43692
Target Species
Human
Target Name
PI15
Target Full Name
Peptidase inhibitor 15
Target Function
Serine protease inhibitor which displays weak inhibitory activity against trypsin. May play a role in facial patterning during embryonic development.
Target Subcellular Location
Secreted.
Target Protein Families
CRISP family
Target Tissue Specificity
Weakly expressed. Expressed at low level in prostate, mammary gland, salivary gland and thyroid gland.
Target Synonyms
25 kDa trypsin inhibitor; CRISP-8; CRISP8; Cysteine rich secretory protein 8; Cysteine-rich secretory protein 8; P24TI; p25TI; Peptidase inhibitor 15; PI-15; PI15; PI15_HUMAN; Protease Inhibitor 15; SugarCrisp
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
