-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PI3 Kinase p110 beta was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-600 of human PI3 Kinase p110 beta (NP_006210.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PI3 Kinase p110 beta was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-600 of human PI3 Kinase p110 beta (NP_006210.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12903A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PI3 Kinase p110 beta |
| Target Synonyms | PI3K; PIK3C1; P110BETA; PI3KBETA; PI3 Kinase p110 beta | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293F, K-562, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 410-600 of human PI3 Kinase p110 beta (NP_006210.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQTNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKEILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK | Uniprot ID | P42338 |
Uniprot Id
P42338
Target Species
Human
Target Name
PIK3CB
Target Full Name
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
Target Function
Phosphoinositide-3-kinase (PI3K) phosphorylates phosphatidylinositol derivatives at position 3 of the inositol ring to produce 3-phosphoinositides. Uses ATP and PtdIns(4,5)P2 (phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Involved in the activation of AKT1 upon stimulation by G-protein coupled receptors (GPCRs) ligands such as CXCL12, sphingosine 1-phosphate, and lysophosphatidic acid. May also act downstream receptor tyrosine kinases. Required in different signaling pathways for stable platelet adhesion and aggregation. Plays a role in platelet activation signaling triggered by GPCRs, alpha-IIb/beta-3 integrins (ITGA2B/ ITGB3) and ITAM (immunoreceptor tyrosine-based activation motif)-bearing receptors such as GP6. Regulates the strength of adhesion of ITGA2B/ ITGB3 activated receptors necessary for the cellular transmission of contractile forces. Required for platelet aggregation induced by F2 (thrombin) and thromboxane A2 (TXA2). Has a role in cell survival. May have a role in cell migration. Involved in the early stage of autophagosome formation. Modulates the intracellular level of PtdIns3P (phosphatidylinositol 3-phosphate) and activates PIK3C3 kinase activity. May act as a scaffold, independently of its lipid kinase activity to positively regulate autophagy. May have a role in insulin signaling as scaffolding protein in which the lipid kinase activity is not required. May have a kinase-independent function in regulating cell proliferation and in clathrin-mediated endocytosis. Mediator of oncogenic signal in cell lines lacking PTEN. The lipid kinase activity is necessary for its role in oncogenic transformation. Required for the growth of ERBB2 and RAS driven tumors.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Interaction with PIK3R2 is required for nuclear localization and export.
Target Protein Families
PI3/PI4-kinase family
Target Tissue Specificity
Expressed ubiquitously.
Target Synonyms
5-bisphosphate 3-kinase 110 kDa catalytic subunit beta; 5-bisphosphate 3-kinase catalytic subunit beta isoform; DKFZp779K1237; MGC133043; OTTHUMP00000216901; OTTHUMP00000216904; p110 BETA; p110Beta; Phosphatidylinositol 3 kinase catalytic beta polypeptide; Phosphatidylinositol 4 5 bisphosphate 3 kinase 110 kDa catalytic subunit beta; Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit beta isoform; Phosphatidylinositol-4; Phosphoinositide 3 kinase catalytic beta polypeptide; PI3 kinase p110 subunit beta; PI3-kinase subunit beta; PI3K; PI3K beta; PI3K-beta; PI3Kbeta; PI3KCB; PIK3C1; Pik3cb; PK3CB_HUMAN; PtdIns 3 kinase p110; PtdIns-3-kinase subunit beta; PtdIns-3-kinase subunit p110-beta
Target Background
This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants.
Notification