-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PI3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-117 of human PI3 (NP_002629.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PI3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-117 of human PI3 (NP_002629.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11199A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PI3 |
| Target Synonyms | ESI; WAP3; SKALP; WFDC14; cementoin; PI3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-117 of human PI3 (NP_002629.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ | Uniprot ID | P19957 |
Uniprot Id
P19957
Target Species
Human
Target Name
PI3
Target Full Name
Elafin
Target Function
Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. Has been shown to inhibit the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor and to produce a weak inhibition on Kv11.1/KCNH2/ERG1 and on the transient receptor potential cation channel subfamily V member 1 (TRPV1).
Target Subcellular Location
Secreted.
Target Research Area
Signal Transduction
Target Synonyms
Cementoin; ELAF_HUMAN; Elafin; Elafin/Skalp; Elastase Specific Inhibitor; Elastase-specific inhibitor; ES 1; ESI; Peptidase inhibitor 3; Peptidase inhibitor 3; skin derived; PI 3; PI-3; PI3; Pre elafin; Protease inhibitor 3 skin derived ; Protease inhibitor 3; skin derived (SKALP); Protease inhibitor WAP3; SKALP; Skin derived Anti leukoproteinase; Skin-derived antileukoproteinase; Trappin 2; WAP four disulfide core domain 14; WAP four disulfide core domain protein 14; WAP four-disulfide core domain protein 14; WAP3; WFDC14
Target Background
This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.
Notification