-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PI4K2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PI4K2B (NP_060793.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PI4K2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PI4K2B (NP_060793.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07046A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PI4K2B |
| Target Synonyms | PIK42B; PI4KIIB; PI4K2B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PI4K2B (NP_060793.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEDPSEPDRLASADGGSPEEEEDGEREPLLPRIAWAHPRRGAPGSAVRLLDAAGEEGEAGDEELPLPPGDVGVSRSSSAELDRSRPAVSVTIGTSEMNAFLDDPEFADIMLRAEQAIEVG | Uniprot ID | Q8TCG2 |
Uniprot Id
Q8TCG2
Target Species
Human
Target Name
PI4K2B
Target Full Name
Phosphatidylinositol 4-kinase type 2-beta
Target Function
Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking.
Target Subcellular Location
Cytoplasm. Membrane. Note=Mostly cytoplasmic but also found associated with the plasma membrane, the Golgi and endosomes. Compared to PI4K2A, a larger fraction of PI4K2B is cytosolic due to a smaller extent of palmitoylation. Translocates to membranes where it is recruited by PDGF stimulation by a Rac-GTP-dependent mechanism.
Target Protein Families
PI3/PI4-kinase family, Type II PI4K subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
2610042N09Rik; 4933409G22Rik; FLJ11105; P4K2B_HUMAN; Phosphatidylinositol 4 kinase type 2 beta; Phosphatidylinositol 4 kinase type II beta; Phosphatidylinositol 4-kinase type 2-beta; Phosphatidylinositol 4-kinase type II-beta; PI4K 2 beta; PI4K 2b; PI4K II beta; PI4K IIb; Pi4k2b; PI4KII-BETA; PI4KIIb; PIK42B; Type II phosphatidylinositol 4 kinase beta isoform
Target Background
This gene encodes a member of the type II PI4 kinase protein family. The encoded protein is primarily cytosolic and contributes to overall PI4-kinase activity along with other protein family members. This protein is involved in early T cell activation.
Notification