-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIAS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 452-628 of human PIAS3 (NP_006090.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PIAS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 452-628 of human PIAS3 (NP_006090.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10702A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIAS3 |
| Target Synonyms | ZMIZ5; PIAS3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F, Mouse thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 452-628 of human PIAS3 (NP_006090.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD | Uniprot ID | Q9Y6X2 |
Uniprot Id
Q9Y6X2
Target Species
Human
Target Name
PIAS3
Target Full Name
E3 SUMO-protein ligase PIAS3
Target Function
Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway and the steroid hormone signaling pathway. Involved in regulating STAT3 signaling via inhibiting STAT3 DNA-binding and suppressing cell growth. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation. Sumoylates CCAR2 which promotes its interaction with SIRT1. Diminishes the sumoylation of ZFHX3 by preventing the colocalization of ZFHX3 with SUMO1 in the nucleus.
Target Subcellular Location
Cytoplasm. Nucleus. Nucleus speckle.
Target Protein Families
PIAS family
Target Tissue Specificity
Widely expressed.
Target Synonyms
E3 SUMO protein ligase PIAS 3; E3 SUMO protein ligase PIAS3; E3 SUMO-protein ligase PIAS3; FLJ14651; OTTHUMP00000015586; OTTHUMP00000015587; PIAS 3; Pias3; PIAS3 protein; PIAS3_HUMAN; Protein inhibitor of activated STAT 3; Protein inhibitor of activated STAT protein 3; Protein inhibitor of activated STAT3; Zinc finger MIZ type containing 5; ZMIZ 5; ZMIZ5
Target Background
This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined.
Notification