Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIGM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-96 of human PIGM (NP_660150.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PIGM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-96 of human PIGM (NP_660150.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07111A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIGM |
| Target Synonyms | GPI-MT-I; PIGM | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Mouse lung, Mouse spleen, Mouse thymus, Rat spleen, Rat thymus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 35-96 of human PIGM (NP_660150.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYLSELFGK | Uniprot ID | Q9H3S5 |
Uniprot Id
Q9H3S5
Target Species
Human
Target Name
PIGM
Target Full Name
GPI mannosyltransferase 1
Target Function
Mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers the first alpha-1,4-mannose to GlcN-acyl-PI during GPI precursor assembly.
Target Involvement
Glycosylphosphatidylinositol deficiency (GPID)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
PIGM family
Target Synonyms
PIGM; GPI mannosyltransferase 1; EC 2.4.1.-; GPI mannosyltransferase I; GPI-MT-I; Phosphatidylinositol-glycan biosynthesis class M protein; PIG-M
Target Background
This gene encodes a transmembrane protein that is located in the endoplasmic reticulum and is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI)-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a mannosyltransferase, GPI-MT-I, that transfers the first mannose to GPI on the lumenal side of the endoplasmic reticulum.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
