-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIGP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-158 of human PIGP (NP_710148.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PIGP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-158 of human PIGP (NP_710148.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05050A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIGP |
| Target Synonyms | DCRC; DSRC; DEE55; DSCR5; PIG-P; DCRC-S; EIEE55; PIGP | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-158 of human PIGP (NP_710148.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN | Uniprot ID | P57054 |
Uniprot Id
P57054
Target Species
Human
Target Name
PIGP
Target Full Name
Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
Target Function
Part of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex that catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol and participates in the first step of GPI biosynthesis.
Target Involvement
Epileptic encephalopathy, early infantile, 55 (EIEE55)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
PIGP family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
PIGP; DCRC; DSCR5; DSCRC; NPD010; Phosphatidylinositol N-acetylglucosaminyltransferase subunit P; Down syndrome critical region protein 5; Down syndrome critical region protein C; Phosphatidylinositol-glycan biosynthesis class P protein; PIG-P
Target Background
This gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a component of the GPI-N-acetylglucosaminyltransferase complex that catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). This gene is located in the Down Syndrome critical region on chromosome 21 and is a candidate for the pathogenesis of Down syndrome. This gene has multiple pseudogenes and is a member of the phosphatidylinositol glycan anchor biosynthesis gene family. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification