Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIGR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-600 of human PIGR (NP_002635.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PIGR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-600 of human PIGR (NP_002635.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11666A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIGR |
| Target Synonyms | PIGR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse liver, Mouse lung, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 460-600 of human PIGR (NP_002635.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQ | Uniprot ID | P01833 |
Uniprot Id
P01833
Target Species
Human
Target Name
PIGR
Target Full Name
Polymeric immunoglobulin receptor
Target Function
Mediates selective transcytosis of polymeric IgA and IgM across mucosal epithelial cells. Binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process, a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment.; Through its N-linked glycans ensures anchoring of secretory IgA (sIgA) molecules to mucus lining the epithelial surface to neutralize extracellular pathogens. On its own (free form) may act as a non-specific microbial scavenger to prevent pathogen interaction with epithelial cells
Target Subcellular Location
[Polymeric immunoglobulin receptor]: Cell membrane; Single-pass type I membrane protein.; [Secretory component]: Secreted.
Target Synonyms
PIGR; Polymeric immunoglobulin receptor; PIgR; Poly-Ig receptor; Hepatocellular carcinoma-associated protein TB6
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
