Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIGU was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PIGU (NP_536724.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PIGU was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PIGU (NP_536724.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11580A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIGU |
| Target Synonyms | GAB1; PIG-U; NEDBSS; CDC91L1; GPIBD21; PIGU | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PIGU (NP_536724.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQ | Uniprot ID | Q9H490 |
Uniprot Id
Q9H490
Target Species
Human
Target Name
PIGU
Target Full Name
Phosphatidylinositol glycan anchor biosynthesis class U protein
Target Function
Component of the GPI transamidase complex. May be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
PIGU family
Target Synonyms
5430426F17Rik; BC028278; Cdc91l1; Cell division cycle 91 like 1 protein; Cell division cycle protein 91-like 1; GAB1; GPI transamidase component PIG-U; GPI transamidase subunit; Phosphatidylinositol glycan anchor biosynthesis class U; Phosphatidylinositol glycan anchor biosynthesis class U protein; Pigu; PIGU_HUMAN; Protein CDC91 like 1; Protein CDC91-like 1
Target Background
The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Cdc91, a predicted integral membrane protein that may function in cell division control. The protein encoded by this gene is the fifth subunit of GPI transamidase that attaches GPI-anchors to proteins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
