-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIST/GOPC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PIST/GOPC (Q9HD26) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PIST/GOPC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PIST/GOPC (Q9HD26) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14121A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIST/GOPC |
| Target Synonyms | CAL; FIG; PIST; GOPC1; dJ94G16.2; PIST/GOPC | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, Mouse lung, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PIST/GOPC (Q9HD26). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVD | Uniprot ID | Q9HD26 |
Uniprot Id
Q9HD26
Target Species
Human
Target Name
GOPC
Target Full Name
Golgi-associated PDZ and coiled-coil motif-containing protein
Target Function
Plays a role in intracellular protein trafficking and degradation. May regulate CFTR chloride currents and acid-induced ASIC3 currents by modulating cell surface expression of both channels. May also regulate the intracellular trafficking of the ADR1B receptor. May play a role in autophagy. Overexpression results in CFTR intracellular retention and degradation in the lysosomes.
Target Involvement
A chromosomal aberration involving GOPC is found in a glioblastoma multiforme sample. An intra-chromosomal deletion del(6)(q21q21) is responsible for the formation of GOPC-ROS1 chimeric protein which has a constitutive receptor tyrosine kinase activity.
Target Subcellular Location
Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein. Golgi apparatus, trans-Golgi network membrane; Peripheral membrane protein. Cell junction, synapse. Cell junction, synapse, postsynaptic density. Cell projection, dendrite.
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
CAL; CFTR associated ligand; CFTR-associated ligand; dJ94G16.2; dJ94G16.2 PIST; FIG; Fused in glioblastoma; Golgi associated PDZ and coiled coil motif containing; Golgi associated PDZ and coiled coil motif containing protein; Golgi-associated PDZ and coiled-coil motif-containing protein; GOPC 1; GOPC; GOPC_HUMAN; GOPC1; OTTHUMP00000040403; PDZ protein interacting specifically with TC 10; PDZ protein interacting specifically with TC10; PDZ/coiled coil domain binding partner for the rho family GTPase TC 10; PDZ/coiled coil domain binding partner for the rho family GTPase TC10; PIST; Protein interacting specifically with Tc 10; Protein interacting specifically with Tc10
Target Background
This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are infertile. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification